1. Notes: 143 / 9 hours ago  from kurenai24 (originally from martym)

    martym:

    holl-obrien asked : Derek or Scott ?
    "Be a werewolf. Not a teen wolf.”
            “I’m the hot girl.”
  2. Notes: 143 / 10 hours ago  from kurenai24 (originally from martym)

    martym:

    holl-obrien asked : Derek or Scott ?
    "Be a werewolf. Not a teen wolf.”
            “I’m the hot girl.”
  3. Notes: 259 / 10 hours ago  from thempress (originally from allerasphinx)

    Anonymous said: Hi I'm fairly new to tumblr and I'm really curious as to why male slash fandom seems to be the domain of cis-het white women? Like I would have thought that would be something that appealed primarily to gay men, but every tag is 98% women, mostly white. Why is that the case? It has to go beyond patriarchy and internalized sexism; I assume that's the reason for some it, but for all of it? I just don't understand. Thanks for your time.

    allerasphinx:

    So, I have this theory that it has to do with how women and non-hetero ppl, and people of colour in particular are marginalised in narratives and society in general (and to different degrees depending on intersections). 

    Most narratives revolve around white male people, so we’re socialised to accept their humanity in all forms—no matter if they’re they’re literally Satan—and to see ourselves reflected through them. My guess is that hetero white women are projecting their power fantasies onto the easiest characters to imagine themselves as: the characters with the most agency, power and privilege in society. I would say “the most well-rounded characters,” but even shitty weak white male characters have plenty of stans, so clearly they don’t have to be well-written—it’s just that we’re used to accepting these characters despite their faults.

    Sexuality comes into play as well because female sexuality is demonised, so it’s more acceptable to explore male sexuality and desires. They’re also projecting their sexual power fantasies onto these characters.

    Since people of colour are fetishised in varying ways, our sexualities are even less explored. Note how fandom perpetuates the racial stereotypes about black women being “strong” and not “needing” any lovers or romantic attachments. Look at the way fandom reacts to black female characters having love interests while trying to save the world—she can do both, but people don’t want to accept that. Our humanity and sexuality isn’t explorable for them—they can’t see themselves in us, no matter how well-written we are.

    This is as much the fault of our society as it is the fault of the individuals who choose not to examine their prejudices when they have the means to.

    It’s a perpetual cycle too because they’ve internalised sexism and are complicit in/benefit from racism from the time they’re kids, so they end up not being able to identify with female characters and characters of colour. This problem also goes unchecked because people think that women (predominantly white women in this context because if we’re discussing Yaoi for example then it’s a slightly different conversation) writing white male/male pairings and participating in male slash fandom is progressive (I used to think like this and then thankfully the scales fell from my eyes).

    I also think that white gay men aren’t only treated as accessories in media, but upheld as the standard of the lgbtq movement. Most of the representation goes to cis gay white men, so there’s this weird situation where people aren’t only fetishising them/their sexuality, but accessing their privilege.

  4. Notes: 288 / 10 hours ago  from kurenai24 (originally from arefactions)
    slapface:


you’re sixteen years old
you’re a child

#’scott’s life isn’t that bad- he needs to stop complaining’ #ha #haha#hahahahahaha fuck you
     
  5. Notes: 48 / 10 hours ago  from kurenai24 (originally from darkbamators)
    
There’s a new fairy tale in the ghost world..

    There’s a new fairy tale in the ghost world..

    (Source: darkbamators)

     
  6. Notes: 155 / 1 day ago  from sakuta-ryusei
    sakuta-ryusei:

Another Yoshi update.  A lot of people don’t know this, but before Yoshi was cast as Koda (Dino Charge Blue) he was the suit actor for Robo Knight in Megaforce.A few days ago on facebook he announced that he was going to have to get rid of his Gosei Knight/Robo Knight standee before he left to start filming.  So, not only did he give it away, Yoshi himself delivered it to the fan’s door, along with a personalized message.I really can’t with him, he’s so adorable.

    sakuta-ryusei:

    Another Yoshi update.  A lot of people don’t know this, but before Yoshi was cast as Koda (Dino Charge Blue) he was the suit actor for Robo Knight in Megaforce.

    A few days ago on facebook he announced that he was going to have to get rid of his Gosei Knight/Robo Knight standee before he left to start filming.  So, not only did he give it away, Yoshi himself delivered it to the fan’s door, along with a personalized message.

    I really can’t with him, he’s so adorable.

     
  7. Notes: 64254 / 1 day ago  from sourcedumal (originally from thewaywardqueen)

    theblanknotebook:

    Your Body Is Beautiful And You Are A G o d d e s s 

    Reblogging again because YES!

    (Source: thewaywardqueen)

  8. Notes: 98 / 2 days ago  from ealperin (originally from androgynish)
    courtneytrouble:

androgynish:

Director Courtney Trouble with Jiz Lee and Dylan Ryan at the AVN Awards in Las Vegas.

#TBT to the first “queer porn mafia” red carpet moment

    courtneytrouble:

    androgynish:

    Director Courtney Trouble with Jiz Lee and Dylan Ryan at the AVN Awards in Las Vegas.

    #TBT to the first “queer porn mafia” red carpet moment

     
  9. Notes: 381543 / 2 days ago  from ealperin (originally from lumos5001)

    sneakyfeets:

    thesmexyslender:

    tennants-hair:

    VIVA LA PLUTO MOTHERFUCKERS!!!!

    DO YOU SEE THIS? DO YOU? ALL OF YOU WHO HAD WRITTEN OFF PLUTO, WHO HAD CROSSED IT OFF YOUR PLANET LIST? REMEMBER HOW IT WAS ‘TOO SMALL” TO BE A PLANET? HOW NASA, IN COLLABORATION WITH THE INTERNATIONAL ASTRONOMICAL UNION REMOVED ITS PLANETARY STATUS AND  CHANGED ITS NAME TO 134340? HOW EVERYONE THEN CONSIDERED THERE TO BE EIGHT PLANETS, NOT NINE?

    BUT SOME OF US REMAINED LOYAL TO PLUTO. IT WAS NEVER FORGOTTEN. AND NOW HERE WE ARE, AND JUSTICE IS UPON US AFTER 8 YEARS.

    BECAUSE GUESS WHAT? PLUTO HAS AT LEAST FIVE MOONS, A PRETTY BIG NUMBER FOR A ”DWARF-PLANET”, HUH? ESPECIALLY WHEN EARTH, QUITE BIGGER THAN PLUTO AND AN OFFICIAL PLANET ONLY HAS ONE. AND GUESS WHAT ELSE? ERIS, THE PLANET WHICH EVERYONE THOUGHT TO BE BIGGER THAN PLUTO, MAY NOT BE BIGGER AFTER ALL. AND THE BEST PART IS THAT PLUTO HAS AN ATMOSHPERE. THAT’S RIGHT, LADIES AND GENTLEMEN, A SUPPOSEDLY NON-PLANET HAS AN ATMOSPHERE. AGAIN, ISN’T THAT IMPRESSIVE?

    SO LOOK AT THIS. NEW FINDINGS, AND A NEW AGE FOR PLUTO. AN AGE OF RECOGNITION AND APPRECIATION. AND ALLOW ME TO CLOSE THIS -somewhat aggressive-PRESENTATION OF OPINION WITH THE MOTTO OF THE PLUTO APOLOGISTS: VIVA LA PLUTO!

    The revolution has begun

    I don’t know why we took such great offense to pluto’s de-planetization we just did and still do

    (Source: lumos5001)

  10. Notes: 9393 / 2 days ago  from vivamsmolly (originally from teen-wolf)

    Some wounds take longer. And some leave scars, but not for people like you. So what’s going on?

    (Source: teen-wolf)

avatar_128
 
 
The generally SFW blog of a mid-20's gay fool. I run a Monica Rambeau blog (monicarambeau.tumblr.com) and a NSFW blog (permissivepleasure.tumblr.com)
Check 'me if you're interested.
 
 

Following

redthaemotionalfriendealperinamuzed1northstarfanrenamokwhoistorulebarecaveretrogasmtintomatotopallerasphinxpervertsofcolorjustjasperdazzledfirestarthegoodsadistsansastarkstraightuntilthelightsgooutamberushgronthefurrylibrarianvivamsmollymoonlite-suspenderstwoxheartedxdreamashanti-notthesingermeandrousmourningoberynrazycrandomcuntfalulatonksthesassyblacknerdfuckyeahsansastarkbelinskycocktastekurenai24lgbtlaughsbisexxxuwellnatfacespandexualcharactersofcolourbeardedandblackmagalimoonsinfinitegasiansthelastgleekbendernegritaaafloacistsoyelgueroytupopitadiannarileyguanyunchangladysaviourslilliepthe-bitch-goddess-successprgirlsrockxlivvielockextopnotchassrugbysockladguysinshortsandsocksharibookyssthis16sapphoshandsrangerdudesthequeenofshebasaysthugsandtwinksmmanalysisbilliondollarsontheelevatorgalentinesqueerandpresentdangerunderwearjunkieeros-turannosanindiscriminatecollectionimaginescilesxandgunnnightvaleofcolorthempresscutechubbybrownboyfuckyeahhugepenisthewaxlionsugarbootylizzeh-boonikitaduncantensionandthrillohdaddygaysexlaffbendingambellevivabennettjsmooth13bananaleavesleatherpumpkinspurlunkdemarchesglossylaliarhllorsthatblckgrlsquintyoureyesskrull2112tryptophanbonfiresmorganxreidfashioninfographicshairymenofcolorscottmccallisbetterthanurfavesfuckyeahrichonneheroicssamcedesfanfictionkeahimakuaredhotbossexxxisbeautifulpatbeeasiabearthefinesidesassyblacknerdboymeetsworldgifsbisexual-booksifitgivesyoujoyblackbdsmeth3ralbana05classicladiesofcolordarylandglennmistyknightsjessehimselffyeahstormandwolviegingerpeachy1signalfire15vocelisesthetopofthecityjohnnyturturrosethiopiennerufiozukogingerboysjokeperaltakirstintherecklessrangermanialoveblkmengoddesspharoruckawriterhappybdsmbitteroreopousseysnowkarnythiadarkflexmaybe-i-do-it-to-protect-youask-rita-repulsa-blogglamaphonicsombrero91tw31988palaceofposeygayinterracialnudesexyblackmentotoefyeahmilesmoralesstefonniethekingswarriorqueenmodelsofcolorhotelsongskanehawaii808hairyfairysroojieqalmosthumangifscosplayingwhileblackunapproachableblackchickschewableprosepr0nforsocialchangeahappytraillavernecoxpermissivepleasuremurderouscupcakemasteradeptblogofimpossiblethingsdailykeahuprocrasturbatingfckyeahblackgaycouplesmightfindmevaluabletroiancedesfychocolatethunderandprettyboyushkorileyvintageblackglamourthecoloredbodydeliciousasianfuckyeahsodomitesmichonnesfuckyeahboysinskirtsthebigblackwolfefuckyeahsamstevefuckyeahichabbieimthefalconfuckyeahpolyamoryfyshawnangelafamousmeatgingerfeverororomunroemc1r63tomphelan9aznguymadnessfrecklesfascinationftmfuckergingermenxoxogossipgitasexualiteacargsdoodlesphatbootyprincebeautifulbisexualshotguyswithcatsuryelgaygreekgladiator4asianguyssexisnottheenemyianmickeysubmissiveguycomicscariositydarwin-havokushistoryminuswhiteguyscelestedoodlessexyliciouskoreansjsmooth995blondsgingersbigtimegifsblackfemalesuperheroesuniqueasianseverythingbutsterekstilesdannyftmpornfourthemovieladiesmakingcomicsfyeahsamwilsonsmediumshirtsfuckyeahpervyfangirlsxgenepositiveblackgaypornoallthechocolatesintheboxfuckyeahnoahsarcfuckyeahosricchauoliverandpercyfuckyeahmultiracialfuckyeaholdermenfuckyeahdarlennfuckyeahricstarmonica-rambeaustrictly-hawaiianhotmenofkoreaaramisxporthosfuckyeahinterracialcouplesfuckyeahiangallagherthingsidlettylerposeydothegingermilitiafuckyeahethnicmodelsblackgirlgeekhuxtablemilfkoreansexgodsfuckyeahftmsofcoloramazonboytoychromaticcomicstaysteepousseysexygoaliedannygayporngifsfuckyeahtranspornfuckyeahgingerboyzthieves-r-usstannymahealinskirettatweetstvfuckyeahmtfslezgethistoricaldaughtersofthedragonfuckyeahscilesnakedgingerfyeahqueervintagequeersmutlovelymeninskirtsamortentiaporrupemmaprotectorofharlemfuckyeahbrownpeoplebigtimejarlosfyeahshamelessusfuckyeahboostlepercywoodfuckyesbonniebennettblackvintageshameless-usabi-urgesfyeahjanecurtinbiracialcouplescutelgbtcouplesfuckyeahronperlmaninterracialqueerlovefuckyeahwonderwoman
 

Tumblr